Exendin 4 – Potent GLP-1R agonist – Hormones
Exendin-4 is a 39-amino acid peptide incretin mimetic. Exendin-4,also known as Exenatide,was originally isolated from the venom of Gila monster lizard called Heloderma suspectum1. This potent GLP-1R agonist is a long-acting analog of the mammalian intestinal hormone glucagon-like peptide I (GLP-1) and therefore exhibits glucoregulatory activities to control plasma glucose levels2. Exendin-4 enhances insulin synthesis and secretion in a glucose-dependent manner,while downregulating inappropriately high glucagon release,slowing gastric emptying and decreasing appetite2. The increase in maximum insulin secretion is due to a greater increase in cAMP production in pancreatic β cells3. Exendin-4 is a potent agonist of the Glucagon-Like Peptide-1 Receptor (GLP-1R ; Kd = 136pM). It has been reported that exendin-4 is a more potent insulinotropic agent when given intravenously to rats than is glucagon-like peptide-1 (GLP-1) as indicated by the lower ED50 (ED50 0.19 nmol/kg for glucagon-like peptide-1 versus 0.0143 nmol/kg for exendin-4)3. Subcutaneous administration of exendin-4 at doses of 5µg and 10 µg twice daily attenuates glycemia in patients with type 2 diabetes,who are treated with metformin,an antidiabetic drug and not achieving adequate glycemic control4. In these patients,exendin-4 was tolerated and triggered a reduction in glycated hemoglobin (HbA1C ≤ 7%),with no weight gain and no increased incidence of hypoglycemia4. Long-term treatment with exendin-4 has a beneficial effect on the pancreatic β-cell function by stimulating both the neogeneration and the proliferation of β-cells when administered to rats2. Furthermore,exendin-4 has shown anti-atherosclerogenetic properties5 as well as the ability to reduce hepatic steatosis in obese ob/ob mice by improving insulin sensitivity6.
Technical specification
| Sequence | HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 |
|---|---|
| MW | 4 186.6 Da (C₁₈₄H₂₈₂N₅₀O₆₀S) |
| Purity | > 95% |
| Counter-ion | TFA Salts (see option TFA removal) |
| Delivery format | Freeze dried in propylene 2mL microtubes |
Price
| Product | Size | Price € | Price $ |
|---|---|---|---|
| NJ029-05MG | 0.5 mg | 110 € | 138 $ |
| NJ029-1MG | 1 mg | 176 € | 220 $ |
| NJ029-5*1MG | 5x1 mg | 616 € | 770 $ |
